Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small lysine-rich protein 1 (SMKR1), Biotinylated

This Recombinant Human Small lysine-rich protein 1 (SMKR1), Biotinylated spans the amino acid sequence from region 1-65. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small lysine-rich protein 1 SMKR1

UniProt

H3BMG3

Expression Region

1-65

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPAKGKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHLRGFHWPGAPKGKKGRSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Serpin B5/Maspin Antibody (SERPINB5/4977) [Alexa Fluor 594]
NBP3-14137AF594 0.1 mL

Mouse Monoclonal Serpin B5/Maspin Antibody (SERPINB5/4977) [Alexa Fluor 594]

Sign In for Pricing
View Details
Spdya AAV siRNA Pooled Vector
45248166 1.0 µg

Spdya AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Anti-Phospho-Amyloid-beta (T743) APP Antibody
A00081T743 100 µL

Anti-Phospho-Amyloid-beta (T743) APP Antibody

Sign In for Pricing
View Details
Rat Adrenocorticotropic Hormone (ACTH) ELISA Kit
BSKR60710-01 48 Tests

Rat Adrenocorticotropic Hormone (ACTH) ELISA Kit

Sign In for Pricing
View Details
Rat Adrenocorticotropic Hormone (ACTH) ELISA Kit
BSKR60710-02 96 Tests

Rat Adrenocorticotropic Hormone (ACTH) ELISA Kit

Sign In for Pricing
View Details
Automatic Veterinary 3-Diff Hematology Analyzer
LX350HMA 1 Unit

Automatic Veterinary 3-Diff Hematology Analyzer

Sign In for Pricing
View Details