Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 7A (LCE7A), Biotinylated

This Recombinant Human Late cornified envelope protein 7A (LCE7A), Biotinylated spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 7A LCE7A

UniProt

P0DV60

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSYQKHQQKWQLPAKCLPKYPSKWTPQAPASCPAPCPPPAPSCCVSSCCISGFGGHCSLVSLRFPRFYLRQPQHSDCCEHESSRCSTCYSSGDCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TMEM143 Antibody [Alexa Fluor 700]
NBP2-98096AF700 0.1 mL

Rabbit Polyclonal TMEM143 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
RNA polymerase II Polyclonal Antibody, Cy3 Conjugated
bs-6972R-Cy3 100 µL

RNA polymerase II Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Rat Tracheal Smooth Muscle Cells
ARP0181 0.5 Million

Rat Tracheal Smooth Muscle Cells

Sign In for Pricing
View Details
Mouse Monoclonal TMIGD2 Antibody (953730) [DyLight 755]
MAB83161IR 100 µL

Mouse Monoclonal TMIGD2 Antibody (953730) [DyLight 755]

Sign In for Pricing
View Details
Neutrophil Cytosolic Factor 1 (NCF1) Magnetic Luminex Assay Kit
LKU601568 96 Tests

Neutrophil Cytosolic Factor 1 (NCF1) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
CleriGel™ Super Gellan gum Plant Culture Tested
PCT0906-10KG 10 Kg

CleriGel™ Super Gellan gum Plant Culture Tested

Sign In for Pricing
View Details