Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 7A (LCE7A), Biotinylated

This Recombinant Human Late cornified envelope protein 7A (LCE7A), Biotinylated spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 7A LCE7A

UniProt

P0DV60

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSYQKHQQKWQLPAKCLPKYPSKWTPQAPASCPAPCPPPAPSCCVSSCCISGFGGHCSLVSLRFPRFYLRQPQHSDCCEHESSRCSTCYSSGDCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gsbs-set siRNA/shRNA/RNAi Lentivector (Mouse)
58433094 4x 500 ng

Gsbs-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
CANT1 siRNA (h)
sc-94075 10 µM

CANT1 siRNA (h)

Sign In for Pricing
View Details
TMEM144 Protein Vector (Human) (pPM-C-His)
PV042576 500 ng

TMEM144 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
COL9A1 Antibody
OAAN03576-100UL 100 µL

COL9A1 Antibody

Sign In for Pricing
View Details
1-Acetylthiourea
OR18382 1 Each

1-Acetylthiourea

Sign In for Pricing
View Details
Recombinant Mouse Endoglin
CC028-010 10 µg

Recombinant Mouse Endoglin

Sign In for Pricing
View Details