Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 7A (LCE7A), Biotinylated

This Recombinant Human Late cornified envelope protein 7A (LCE7A), Biotinylated spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 7A LCE7A

UniProt

P0DV60

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSYQKHQQKWQLPAKCLPKYPSKWTPQAPASCPAPCPPPAPSCCVSSCCISGFGGHCSLVSLRFPRFYLRQPQHSDCCEHESSRCSTCYSSGDCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GPR105 P2RY14 Antibody
A09607-1 100 µL

Anti-GPR105 P2RY14 Antibody

Sign In for Pricing
View Details
Human DAO/D-amino-acid oxidase ELISA Kit
E0656Hu 96 Tests

Human DAO/D-amino-acid oxidase ELISA Kit

Sign In for Pricing
View Details
HB-EGF, Human
Z03291-1 1 mg

HB-EGF, Human

Sign In for Pricing
View Details
Mouse Man2a1 Pre-designed siRNA Set A
SI108075A 1 Each

Mouse Man2a1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Phospho-IKKα/β (Ser176/180) (16A6) Rabbit Monoclonal Antibody (PE Conjugate)
CST 14938S 100 µL

Phospho-IKKα/β (Ser176/180) (16A6) Rabbit Monoclonal Antibody (PE Conjugate)

Sign In for Pricing
View Details
Stxbp4 siRNA Oligos set (Rat)
45811176 3x 5 nmol

Stxbp4 siRNA Oligos set (Rat)

Sign In for Pricing
View Details