Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 7A (LCE7A), Biotinylated

This Recombinant Human Late cornified envelope protein 7A (LCE7A), Biotinylated spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 7A LCE7A

UniProt

P0DV60

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSYQKHQQKWQLPAKCLPKYPSKWTPQAPASCPAPCPPPAPSCCVSSCCISGFGGHCSLVSLRFPRFYLRQPQHSDCCEHESSRCSTCYSSGDCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HOMER2 knockout cell line
ABC-KH6924 1 Vial

Human HOMER2 knockout cell line

Sign In for Pricing
View Details
FZD8 Rabbit Polyclonal Antibody
orb330169 100 µL

FZD8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VPS35 Antibody
orb612808 100 µg

VPS35 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Pvalb shRNA (UAS) - Lentiviral mouse Pvalb shRNA (UAS) (100)
GTR15194982 1 Vial

Lentiviral mouse Pvalb shRNA (UAS) - Lentiviral mouse Pvalb shRNA (UAS) (100)

Sign In for Pricing
View Details
Canine Trefoil Factor 1 ELISA Kit
MBS027116-01 48 Well

Canine Trefoil Factor 1 ELISA Kit

Sign In for Pricing
View Details
Canine Trefoil Factor 1 ELISA Kit
MBS027116-02 96 Well

Canine Trefoil Factor 1 ELISA Kit

Sign In for Pricing
View Details