Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Embryonic testis differentiation protein homolog A (ETDA), Biotinylated

This Recombinant Human Embryonic testis differentiation protein homolog A (ETDA), Biotinylated spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Embryonic testis differentiation protein homolog A ETDA

UniProt

Q3ZM63

Expression Region

1-59

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDKEVPKGSPREPALNIKKSDKSFKRKKPTENVLIFLINRQLGRHRSDIDLSRWVWMLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coa5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7565807 1.0 µg DNA

Coa5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Human TrpRS protein (N-6His)
CD00759-01 10 µg

Recombinant Human TrpRS protein (N-6His)

Sign In for Pricing
View Details
Recombinant Human TrpRS protein (N-6His)
CD00759-02 50 µg

Recombinant Human TrpRS protein (N-6His)

Sign In for Pricing
View Details
GRB7 (NM_001030002) Human Recombinant Protein
PROTQ14451 20 µg

GRB7 (NM_001030002) Human Recombinant Protein

Sign In for Pricing
View Details
FAM201C AAV Vector (Human) (CMV)
19921101 1 µg

FAM201C AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rabbit Polyclonal Stanniocalcin 2/STC-2 Antibody [Alexa Fluor 594]
NBP3-00170AF594 0.1 mL

Rabbit Polyclonal Stanniocalcin 2/STC-2 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details