Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein GAFA-1 (GAFA1), partial, Biotinylated

This Recombinant Human Putative uncharacterized protein GAFA-1 (GAFA1), partial, Biotinylated spans the amino acid sequence from region 27-74. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein GAFA-1; Gene associated with FGF-2 activity protein 1; GAFA1

UniProt

Q96PS6

Expression Region

27-74

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RWSLTLSLRLECSSAIIKPTAASNSCVQVNLPPSMCDYRHEPLCLAFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr922 Protein Vector (Rat) (pPM-C-HA)
PV291564 500 ng

Olr922 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
PLK2 polyclonal antibody
orb1716370-01 50 µL

PLK2 polyclonal antibody

Sign In for Pricing
View Details
PLK2 polyclonal antibody
orb1716370-02 100 µL

PLK2 polyclonal antibody

Sign In for Pricing
View Details
CD86 Antibody
orb750156-01 20 µg

CD86 Antibody

Sign In for Pricing
View Details
CD86 Antibody
orb750156-02 100 µg

CD86 Antibody

Sign In for Pricing
View Details
CMDJ-set siRNA/shRNA/RNAi Lentivector (Human)
55656091 4x 500 ng

CMDJ-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details