Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein GAFA-1 (GAFA1), partial, Biotinylated

This Recombinant Human Putative uncharacterized protein GAFA-1 (GAFA1), partial, Biotinylated spans the amino acid sequence from region 27-74. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein GAFA-1; Gene associated with FGF-2 activity protein 1; GAFA1

UniProt

Q96PS6

Expression Region

27-74

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RWSLTLSLRLECSSAIIKPTAASNSCVQVNLPPSMCDYRHEPLCLAFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arrb1 (NM_177231) Mouse Untagged Clone
MC212214 10 µg

Arrb1 (NM_177231) Mouse Untagged Clone

Sign In for Pricing
View Details
NUP133 Rabbit pAb, PE-Cy7 conjugated
orb2884668 100 µL

NUP133 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Rabbit anti Mouse IgM
20-B80010000-U4 10 ml

Rabbit anti Mouse IgM

Sign In for Pricing
View Details
Atpaf2 siRNA Oligos set (Rat)
12828176 3x 5 nmol

Atpaf2 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
N-[ (2,6-dichloro-4-methyl-3-pyridyl) carbonyl]-N'- (3,5-dichlorophenyl) urea
OR27117 1 Each

N-[ (2,6-dichloro-4-methyl-3-pyridyl) carbonyl]-N'- (3,5-dichlorophenyl) urea

Sign In for Pricing
View Details
1- (2-Bromophenyl) piperidine
407507-01 100 mg

1- (2-Bromophenyl) piperidine

Sign In for Pricing
View Details