Recombinant Human Negative regulator of P-body association (NBDY)
This Recombinant Human Negative regulator of P-body association (NBDY) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Negative regulator of P-body association; P-body dissociating protein; Protein NoBody; NBDY LINC01420
UniProt
A0A0U1RRE5
Expression Region
1-68
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLKSHPPPPEK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
16507121 3x 1.0µg DNA
CNTD1 CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details 