Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLCO1B3-SLCO1B7 readthrough transcript protein (SO1BT), partial

This Recombinant Human SLCO1B3-SLCO1B7 readthrough transcript protein (SO1BT), partial spans the amino acid sequence from region 431-539. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLCO1B3-SLCO1B7 readthrough transcript protein; Liver specific transporter-3 transmembrane 12; LST-3TM12; Organic anion transporting polypeptide 1B3-1B7; OATP1B3-1B7; Solute carrier organic anion transporter family member 1B3-1B7; SLCO1B3-SLCO1B7; SLCO1B3-SLCO1B7

UniProt

F5H094

Expression Region

431-539

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESKSVAGLTLTYDGNSPVRSHVDVPLSYCNSECNCDESQWEPVCGNNGITYLSPCLAGCKSSSGNKEPIVFYNCSCVEVIGLQNKNYSAHLGECPRDDACTRKSYVYFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wnt10B, ID (Protein Wnt-10b, Wnt-12, Wnt12) (PE) discontinued
W3038-10A-PE 200 µL

Wnt10B, ID (Protein Wnt-10b, Wnt-12, Wnt12) (PE) discontinued

Sign In for Pricing
View Details
FGFBP1 protein (His tag)
80R-4061 50 ug

FGFBP1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Bcl2 Associated X Protein (Bax)
SIPB514Mu02-01 10 µg

Recombinant Bcl2 Associated X Protein (Bax)

Sign In for Pricing
View Details
Recombinant Bcl2 Associated X Protein (Bax)
SIPB514Mu02-02 50 µg

Recombinant Bcl2 Associated X Protein (Bax)

Sign In for Pricing
View Details
Recombinant Bcl2 Associated X Protein (Bax)
SIPB514Mu02-03 200 µg

Recombinant Bcl2 Associated X Protein (Bax)

Sign In for Pricing
View Details
Recombinant Bcl2 Associated X Protein (Bax)
SIPB514Mu02-04 1 mg

Recombinant Bcl2 Associated X Protein (Bax)

Sign In for Pricing
View Details