Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 22 (SIM22), partial

This Recombinant Human Small integral membrane protein 22 (SIM22), partial spans the amino acid sequence from region 1-31. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 22; Cancer-associated small integral membrane open reading frame 1; SMIM22 CASIMO1

UniProt

K7EJ46

Expression Region

1-31

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAVSTEELEATVQEVLGRLKSHQFFQSTWDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tspan32 (BC055858) Mouse Tagged ORF Clone
MG202063 10 µg

Tspan32 (BC055858) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS706867 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
ATP5MC1 (NM_001002027) Human Over-expression Lysate
LC400364 20 µg

ATP5MC1 (NM_001002027) Human Over-expression Lysate

Sign In for Pricing
View Details
Trap1 Antibody: ATTO 390
SMC-207D-A390 100 µg

Trap1 Antibody: ATTO 390

Sign In for Pricing
View Details
Human C3IP1 (KLHL12) activation kit by CRISPRa
GA111833 1 Kit

Human C3IP1 (KLHL12) activation kit by CRISPRa

Sign In for Pricing
View Details
Niemann Pick C1 (NPC1) Human Gene Knockout Kit (CRISPR)
KN209258LP 1 Kit

Niemann Pick C1 (NPC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details