Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial

This Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial spans the amino acid sequence from region 1151-1266. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Doublecortin domain-containing protein 1; Doublecortin domain-containing 5 protein; DCDC1 DCDC5 KIAA1493

UniProt

M0R2J8

Expression Region

1151-1266

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLVEKKSDGSHQRWIHQEDSRTFHLVSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNNGAANQKWHYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Fluoro-7-aza-spiro[3.5]nonane (~90%)
TRC-F588025-250MG 250 mg

2-Fluoro-7-aza-spiro[3.5]nonane (~90%)

Sign In for Pricing
View Details
CYC1 (NM_001916) Human Over-expression Lysate
LY400709 100 µg

CYC1 (NM_001916) Human Over-expression Lysate

Sign In for Pricing
View Details
GIPC (GIPC1) Human Gene Knockout Kit (CRISPR)
KN201175BN 1 Kit

GIPC (GIPC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PS2 (TFF1/1091), CF488A conjugate, 0.1mg/mL
BNC881091-100 1x 100 µL

PS2 (TFF1/1091), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Stomach
CP614036 150 µg

Tissue Protein Lysate, Stomach

Sign In for Pricing
View Details
IL2 Receptor gamma (IL2RG) Rabbit Polyclonal Antibody
TA361165 100 µL

IL2 Receptor gamma (IL2RG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details