Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial

This Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial spans the amino acid sequence from region 1151-1266. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Doublecortin domain-containing protein 1; Doublecortin domain-containing 5 protein; DCDC1 DCDC5 KIAA1493

UniProt

M0R2J8

Expression Region

1151-1266

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLVEKKSDGSHQRWIHQEDSRTFHLVSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNNGAANQKWHYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inosine 2'-phosphate
TRC-I432720-2.5MG 2.5 mg

Inosine 2'-phosphate

Sign In for Pricing
View Details
RRBP1 Human Gene Knockout Kit (CRISPR)
KN418755 1 Kit

RRBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant LRP1 Antibody
RC-6948-01 50 μL

Recombinant LRP1 Antibody

Sign In for Pricing
View Details
Recombinant LRP1 Antibody
RC-6948-02 100 µL

Recombinant LRP1 Antibody

Sign In for Pricing
View Details
Recombinant LRP1 Antibody
RC-6948-03 1 mL

Recombinant LRP1 Antibody

Sign In for Pricing
View Details
Rab1b (NM_029576) Mouse Tagged ORF Clone
MG202049 10 µg

Rab1b (NM_029576) Mouse Tagged ORF Clone

Sign In for Pricing
View Details