Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LINE-1 retrotransposable element ORF2 protein (LORF2), partial

This Recombinant Human LINE-1 retrotransposable element ORF2 protein (LORF2), partial spans the amino acid sequence from region 498-773. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LINE-1 retrotransposable element ORF2 protein; ORF2p; [Includes: Reverse transcriptase; EC 2.7.7.49; Endonuclease; EC 3.1.21.-]

UniProt

O00370

Expression Region

498-773

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SIEKEGILPNSFYEASIILIPKPGRDTTKKENFRPISLMNIDAKILNKILANRIQQHIKKLIHHDQVGFIPGMQGWFNIRKSINVIQHINRAKDKNHVIISIDAEKAFDKIQQPFMLKTLNKLGIDGMYLKIIRAIYDKPTANIILNGQKLEAFPLKTGTRQGCPLSPLLFNIVLEVLARAIRQEKEIKGIQLGKEEVKLSLFADDMIVYLENPIVSAQNLLKLISNFSKVSGYKINVQKSQAFLYNNNRQTESQIMGELPFTIASKRIKYLGIQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gasdermin D (N terminal) Recombinant Rabbit Monoclonal Antibody [PD00-18]
HA721144 100 µL

Gasdermin D (N terminal) Recombinant Rabbit Monoclonal Antibody [PD00-18]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703033 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human IL-3 Mouse Monoclonal Antibody [PSH0-96] - BSA and Azide free (Capture)
HA601153 100 µg

Human IL-3 Mouse Monoclonal Antibody [PSH0-96] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD31 Antibody[390]
E-AB-F1180UG-01 25 µg

PE/Cyanine5 Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD31 Antibody[390]
E-AB-F1180UG-02 100 µg

PE/Cyanine5 Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
Carbonic anhydrase X (CA10) (NM_001082534) Human Recombinant Protein
TP312539L 1 mg

Carbonic anhydrase X (CA10) (NM_001082534) Human Recombinant Protein

Sign In for Pricing
View Details