Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin-C (CYTC)

This Recombinant Human Cystatin-C (CYTC) spans the amino acid sequence from region 27-146. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cystatin-C; Cystatin-3; Gamma-trace; Neuroendocrine basic polypeptide; Post-gamma-globulin; CST3

UniProt

P01034

Expression Region

27-146

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (CC49), CF647 conjugate, 0.1mg/mL
BNC470732-100 1x 100 µL

TAG-72 / CA72.4 (CC49), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,2,3,4,5-Pentanepentacarboxylic Acid Sodium Salt Trihydrate
TRC-P273500-10MG 10 mg

1,2,3,4,5-Pentanepentacarboxylic Acid Sodium Salt Trihydrate

Sign In for Pricing
View Details
TOC Analyzer BANA-604
BANA-604 1 Unit

TOC Analyzer BANA-604

Sign In for Pricing
View Details
CPB1 Rabbit Polyclonal Antibody
TA396910S 25 µL

CPB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF640R conjugate, 0.1mg/mL
BNC402221-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zalutumumab Biosimilar - Research Grade
ICH5116-100mg 100 mg

Zalutumumab Biosimilar - Research Grade

Sign In for Pricing
View Details