Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin-C (CYTC)

This Recombinant Human Cystatin-C (CYTC) spans the amino acid sequence from region 27-146. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cystatin-C; Cystatin-3; Gamma-trace; Neuroendocrine basic polypeptide; Post-gamma-globulin; CST3

UniProt

P01034

Expression Region

27-146

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPRKB (NM_016058) Human Recombinant Protein
TP306008M 100 µg

TPRKB (NM_016058) Human Recombinant Protein

Sign In for Pricing
View Details
SEMA5B (NM_001031702) Human Over-expression Lysate
LY422156 100 µg

SEMA5B (NM_001031702) Human Over-expression Lysate

Sign In for Pricing
View Details
p39 (CDK5R2) Rabbit Polyclonal Antibody
TA361615 100 µL

p39 (CDK5R2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT5A Polyclonal Antibody
E-AB-65556-01 60 µL

STAT5A Polyclonal Antibody

Sign In for Pricing
View Details
STAT5A Polyclonal Antibody
E-AB-65556-02 120 µL

STAT5A Polyclonal Antibody

Sign In for Pricing
View Details
STAT5A Polyclonal Antibody
E-AB-65556-03 200 µL

STAT5A Polyclonal Antibody

Sign In for Pricing
View Details