Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vasopressin-neurophysin 2-copeptin (NEU2), partial

This Recombinant Human Vasopressin-neurophysin 2-copeptin (NEU2), partial spans the amino acid sequence from region 32-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vasopressin-neurophysin 2-copeptin; AVP-NPII; [Cleaved into: Arg-vasopressin; Arginine-vasopressin; Neurophysin 2; Neurophysin-II; Copeptin] AVP ARVP VP

UniProt

P01185

Expression Region

32-124

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdc25c AAV siRNA Pooled Vector
15604164 1.0 µg

Cdc25c AAV siRNA Pooled Vector

Sign In for Pricing
View Details
KCNA10 antibody - middle region (ARP35178_T100)
ARP35178_T100 100 µL

KCNA10 antibody - middle region (ARP35178_T100)

Sign In for Pricing
View Details
XK CytoSection
TS405988P5 25 Slides

XK CytoSection

Sign In for Pricing
View Details
Mouse Anti-Duck IgY (H&L) - AcalephFluor555
CSA3433-01 100 µL

Mouse Anti-Duck IgY (H&L) - AcalephFluor555

Sign In for Pricing
View Details
Mouse Anti-Duck IgY (H&L) - AcalephFluor555
CSA3433-02 500 μL

Mouse Anti-Duck IgY (H&L) - AcalephFluor555

Sign In for Pricing
View Details
Mouse Anti-Duck IgY (H&L) - AcalephFluor555
CSA3433-03 1 mL

Mouse Anti-Duck IgY (H&L) - AcalephFluor555

Sign In for Pricing
View Details