Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myoglobin (MYG)

This Recombinant Human Myoglobin (MYG) spans the amino acid sequence from region 2-154. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myoglobin; Nitrite reductase MB; EC 1.7.-.-; Pseudoperoxidase MB; EC 1.11.1.-; MB

UniProt

P02144

Expression Region

2-154

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF18 Rabbit Polyclonal Antibody
orb585784 100 µL

FGF18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gamma-chlorocrotonic acid
OR941955 1 Each

Gamma-chlorocrotonic acid

Sign In for Pricing
View Details
UBAP1L (NM_001163692) Human Untagged Clone
SC326941 10 µg

UBAP1L (NM_001163692) Human Untagged Clone

Sign In for Pricing
View Details
SERPINA11 (FITC)
576009-01 50 µg

SERPINA11 (FITC)

Sign In for Pricing
View Details
SERPINA11 (FITC)
576009-02 100 µg

SERPINA11 (FITC)

Sign In for Pricing
View Details
ELISA kit for Mouse Soluble myosin heavy chain 1 (sMHC-1)
KTE70891-01 48 Tests

ELISA kit for Mouse Soluble myosin heavy chain 1 (sMHC-1)

Sign In for Pricing
View Details