Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycophorin-A (GLPA), partial

This Recombinant Human Glycophorin-A (GLPA), partial spans the amino acid sequence from region 20-91. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycophorin-A; MN sialoglycoprotein; PAS-2; Sialoglycoprotein alpha; CD antigen CD235a; GYPA GPA MNS

UniProt

P02724

Expression Region

20-91

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF43 Protein Vector (Mouse) (pPM-C-His)
PV224905 500 ng

RNF43 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
KHSRP Recombinant Rabbit mAb
E43S47361 100 µL

KHSRP Recombinant Rabbit mAb

Sign In for Pricing
View Details
IDE Mouse Polyclonal Antibody (APC-Cy7)
orb1974856 100 µL

IDE Mouse Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
FKBP8 antibody - N-terminal region (ARP46862_P050)
ARP46862_P050 100 µL

FKBP8 antibody - N-terminal region (ARP46862_P050)

Sign In for Pricing
View Details
Cinnamyl caffeate
orb1682941 5 mg

Cinnamyl caffeate

Sign In for Pricing
View Details
BCL11A Antibody
CSB-PA872429ESR1HU-01 50 μL

BCL11A Antibody

Sign In for Pricing
View Details