Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycophorin-A (GLPA), partial

This Recombinant Human Glycophorin-A (GLPA), partial spans the amino acid sequence from region 20-91. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycophorin-A; MN sialoglycoprotein; PAS-2; Sialoglycoprotein alpha; CD antigen CD235a; GYPA GPA MNS

UniProt

P02724

Expression Region

20-91

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Cytokeratin 14 Antibody (KRT14/8261R) [Alexa Fluor 750]
NBP3-24292AF750 0.1 mL

Rabbit Monoclonal Cytokeratin 14 Antibody (KRT14/8261R) [Alexa Fluor 750]

Sign In for Pricing
View Details
Albumin Fraction V (pH 7.0) for molecular biology
1126KG005 5 Kg

Albumin Fraction V (pH 7.0) for molecular biology

Sign In for Pricing
View Details
SNORA74B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2221305 3x 1.0 µg

SNORA74B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
PMP2 Polyclonal Antibody, FITC Conjugated
bs-2032R-FITC 100 µL

PMP2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Recombinant Human Transcriptional coactivator YAP1 (YAP1)
MBS9020260-01 0.02 mg (E-Coli)

Recombinant Human Transcriptional coactivator YAP1 (YAP1)

Sign In for Pricing
View Details
Recombinant Human Transcriptional coactivator YAP1 (YAP1)
MBS9020260-02 0.1 mg (E-Coli)

Recombinant Human Transcriptional coactivator YAP1 (YAP1)

Sign In for Pricing
View Details