Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycophorin-A (GLPA), partial

This Recombinant Human Glycophorin-A (GLPA), partial spans the amino acid sequence from region 20-91. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycophorin-A; MN sialoglycoprotein; PAS-2; Sialoglycoprotein alpha; CD antigen CD235a; GYPA GPA MNS

UniProt

P02724

Expression Region

20-91

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MPHOSPH1 Antibody [DyLight 550]
NBP3-05904R 0.1 mL

Rabbit Polyclonal MPHOSPH1 Antibody [DyLight 550]

Sign In for Pricing
View Details
C21orf25 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-9988R-APC-Cy5.5 100 µL

C21orf25 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Mouse Anti Human NFKB-p65 Monoclonal Clone 9B4 200UL
IMSAMLRELA9B4C200UL 200 µL

Mouse Anti Human NFKB-p65 Monoclonal Clone 9B4 200UL

Sign In for Pricing
View Details
4,4'-Dihydroxydiphenyl Ether
TRC-D493435-250MG 250 mg

4,4'-Dihydroxydiphenyl Ether

Sign In for Pricing
View Details
Mouse 1700003E24Rik activation kit by CRISPRa
GA219014 1 Kit

Mouse 1700003E24Rik activation kit by CRISPRa

Sign In for Pricing
View Details
GMPαS, S pack
JBS-NU-1160S 100 µL

GMPαS, S pack

Sign In for Pricing
View Details