Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-B (S100B)

This Recombinant Human Protein S100-B (S100B) spans the amino acid sequence from region 2-92. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; S100B

UniProt

P04271

Expression Region

2-92

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carfilzomib (2R,4S)-2-Hydroxy Acetate
TRC-M687545-2.5MG 2.5 mg

Carfilzomib (2R,4S)-2-Hydroxy Acetate

Sign In for Pricing
View Details
ACAD9 (NM_014049) Human Over-expression Lysate
LY402280 100 µg

ACAD9 (NM_014049) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS641971 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details
5 HT1A (HTR1A) Rabbit Polyclonal Antibody
AP06769PU-N 100 µg

5 HT1A (HTR1A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sssca1 (NM_020491) Mouse Tagged ORF Clone
MG202014 10 µg

Sssca1 (NM_020491) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Medium Water Purification System BDPS-103
BDPS-103 1 Unit

Medium Water Purification System BDPS-103

Sign In for Pricing
View Details