Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inhibin alpha chain (INHA)

This Recombinant Human Inhibin alpha chain (INHA) spans the amino acid sequence from region 233-366. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Inhibin alpha chain INHA

UniProt

P05111

Expression Region

233-366

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTDSPL siRNA Oligos set (Human)
17051171 3x 5 nmol

CTDSPL siRNA Oligos set (Human)

Sign In for Pricing
View Details
FAM76B Polyclonal Antibody, APC Conjugated
bs-9659R-APC 100 µL

FAM76B Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
3-Deoxyinosine
BA4344-10 10 mg

3-Deoxyinosine

Sign In for Pricing
View Details
Vax1 Rat shRNA Lentiviral Particle (Locus ID 64571)
TL710793V 500 µL Each

Vax1 Rat shRNA Lentiviral Particle (Locus ID 64571)

Sign In for Pricing
View Details
RGD1561984 3'UTR Luciferase Stable Cell Line
TU218495 1.0 mL

RGD1561984 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Lipase-A
MBS143741-01 10 mg

Recombinant Lipase-A

Sign In for Pricing
View Details