Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty acid-binding protein, heart (FABPH)

This Recombinant Human Fatty acid-binding protein, heart (FABPH) spans the amino acid sequence from region 2-133. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fatty acid-binding protein, heart; Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP; Mammary-derived growth inhibitor; MDGI; Muscle fatty acid-binding protein; M-FABP; FABP3 FABP11 MDGI

UniProt

P05413

Expression Region

2-133

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGF AAV Vector (Human) (CMV)
31799101 1 µg

NGF AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
TMUB1 Protein Vector (Human) (pPM-C-His)
PV043160 500 ng

TMUB1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
VPS25 Antibody; HRP conjugated
MBS7006582-01 0.05 mg

VPS25 Antibody; HRP conjugated

Sign In for Pricing
View Details
VPS25 Antibody; HRP conjugated
MBS7006582-02 0.1 mg

VPS25 Antibody; HRP conjugated

Sign In for Pricing
View Details
VPS25 Antibody; HRP conjugated
MBS7006582-03 5x 0.1 mg

VPS25 Antibody; HRP conjugated

Sign In for Pricing
View Details
ITCH Antibody
A41680-100UG 100 µg

ITCH Antibody

Sign In for Pricing
View Details