Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-A9 (S10A9)

This Recombinant Human Protein S100-A9 (S10A9) spans the amino acid sequence from region 1-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein S100-A9; Calgranulin-B; Calprotectin L1H subunit; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; MRP-14; p14; S100 calcium-binding protein A9; S100A9 CAGB CFAG MRP14

UniProt

P06702

Expression Region

1-114

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Acetylcholinesterase Recombinant Rabbit monoclonal Antibody
HA725224B 100 µL

Human Acetylcholinesterase Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Glycine, 1kg
PR0608-1kg 1 Kg

Glycine, 1kg

Sign In for Pricing
View Details
Milk Fat Globulin (EDM45), CF405S conjugate, 0.1mg/mL
BNC040942-500 1x 500 µL

Milk Fat Globulin (EDM45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS510735 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
3-Piperidineacetic Acid-d11
TRC-P479942-25MG 25 mg

3-Piperidineacetic Acid-d11

Sign In for Pricing
View Details
ZNF407-AS1 (NM_001008234) Human Over-expression Lysate
LY423406 100 µg

ZNF407-AS1 (NM_001008234) Human Over-expression Lysate

Sign In for Pricing
View Details