Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human U2 small nuclear ribonucleoprotein A' (RU2A)

This Recombinant Human U2 small nuclear ribonucleoprotein A' (RU2A) spans the amino acid sequence from region 2-255. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

U2 small nuclear ribonucleoprotein A'; U2 snRNP A'; SNRPA1

UniProt

P09661

Expression Region

2-255

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Soft tissue
CS639846 5x 5 µm

Frozen Tissue Sections, Soft tissue

Sign In for Pricing
View Details
Human AJAP1 activation kit by CRISPRa
GA111073 1 Kit

Human AJAP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Vmn1r65 Mouse Gene Knockout Kit (CRISPR)
KN519080 1 Kit

Vmn1r65 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(2R,3R,4S,5R)-1,2:4,5-Di-O-isopropylidene-3-nonadecanol
TRC-D459100-25MG 25 mg

(2R,3R,4S,5R)-1,2:4,5-Di-O-isopropylidene-3-nonadecanol

Sign In for Pricing
View Details
SSH3 Rabbit Polyclonal Antibody
TA362328 100 µL

SSH3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2C-B Hydrochloride
TRC-D469650-50MG 50 mg

2C-B Hydrochloride

Sign In for Pricing
View Details