Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pepsin A-3 (PEPA3)

This Recombinant Human Pepsin A-3 (PEPA3) spans the amino acid sequence from region 63-388. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pepsin A-3; EC 3.4.23.1; Pepsinogen-3; PGA3

UniProt

P0DJD8

Expression Region

63-388

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit
MBS456972-01 48 Tests

Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit

Sign In for Pricing
View Details
Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit
MBS456972-02 96 Tests

Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit

Sign In for Pricing
View Details
Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit
MBS456972-03 5x 96 Tests

Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit

Sign In for Pricing
View Details
Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit
MBS456972-04 10x 96 Tests

Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit

Sign In for Pricing
View Details
Zfp26 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
50888064 1.0 µg DNA

Zfp26 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RPL7P11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1889707 1.0 µg DNA

RPL7P11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details