Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pepsin A-3 (PEPA3)

This Recombinant Human Pepsin A-3 (PEPA3) spans the amino acid sequence from region 63-388. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pepsin A-3; EC 3.4.23.1; Pepsinogen-3; PGA3

UniProt

P0DJD8

Expression Region

63-388

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-[2-(p-Cinnamylamino)ethyl]-5-isoquinolone Sulfonamide
TRC-C442100-10MG 10 mg

N-[2-(p-Cinnamylamino)ethyl]-5-isoquinolone Sulfonamide

Sign In for Pricing
View Details
CSRP1 Rabbit Polyclonal Antibody (BF350)
orb2518111 100 µL

CSRP1 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
MAPK12 Rabbit pAb
E45R19641N-50 50 µL

MAPK12 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Human BEX1 Protein, His, E.coli-10ug
QP11157-10ug 10ug

Recombinant Human BEX1 Protein, His, E.coli-10ug

Sign In for Pricing
View Details
Recombinant Chlamydophila Trachomatis xerC Protein (aa 1-315) (strain D/UW-3/Cx)
VAng-Lsx7372-500gEcoli 500 µg (E. coli)

Recombinant Chlamydophila Trachomatis xerC Protein (aa 1-315) (strain D/UW-3/Cx)

Sign In for Pricing
View Details
HSPE1 siRNA (Mouse)
CRM1953-01 15 nmol

HSPE1 siRNA (Mouse)

Sign In for Pricing
View Details