Recombinant Human Choriogonadotropin subunit beta 3 (CGB3)
This Recombinant Human Choriogonadotropin subunit beta 3 (CGB3) spans the amino acid sequence from region 21-165. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Choriogonadotropin subunit beta 3; Choriogonadotropin subunit beta; CG-beta; Chorionic gonadotropin chain beta; CGB3 CGB; CGB5; CGB8
UniProt
P0DN86
Expression Region
21-165
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471422-100 1x 100 µL
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940418-500 1x 500 µL
Fascin-1 (FSCN1/418), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details