Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Choriogonadotropin subunit beta 3 (CGB3)

This Recombinant Human Choriogonadotropin subunit beta 3 (CGB3) spans the amino acid sequence from region 21-165. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Choriogonadotropin subunit beta 3; Choriogonadotropin subunit beta; CG-beta; Chorionic gonadotropin chain beta; CGB3 CGB; CGB5; CGB8

UniProt

P0DN86

Expression Region

21-165

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rras2 (NM_001013434) Rat Tagged ORF Clone
RR200798 10 µg

Rras2 (NM_001013434) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Anti-RFX3 antibody
STJ95431 200 µl

Anti-RFX3 antibody

Sign In for Pricing
View Details
Eralpha, phosphorylated (Tyr537) (Estrogen Receptor alpha, ESR1, ER, ESR, Era, ESRA, ESTRR, NR3A1)
368724 100 µL

Eralpha, phosphorylated (Tyr537) (Estrogen Receptor alpha, ESR1, ER, ESR, Era, ESRA, ESTRR, NR3A1)

Sign In for Pricing
View Details
NECAB2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1414104 1.0 µg DNA

NECAB2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Tetrahydrocannabivarol
FT172555-01 25 mg

Tetrahydrocannabivarol

Sign In for Pricing
View Details
Tetrahydrocannabivarol
FT172555-02 50 mg

Tetrahydrocannabivarol

Sign In for Pricing
View Details