Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 2 (IGLC2)

This Recombinant Human Immunoglobulin lambda constant 2 (IGLC2) spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda constant 2; Ig lambda chain C region Kern; Ig lambda chain C region NIG-64; Ig lambda chain C region SH; Ig lambda chain C region X; Ig lambda-2 chain C region; IGLC2

UniProt

P0DOY2

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMTR2 Polyclonal Antibody
A58606-050 50 µL

CMTR2 Polyclonal Antibody

Sign In for Pricing
View Details
Monkey Interferon Gamma Receptor 1 (IFNGR1) Protein
abx600269-01 20 µg

Monkey Interferon Gamma Receptor 1 (IFNGR1) Protein

Sign In for Pricing
View Details
Monkey Interferon Gamma Receptor 1 (IFNGR1) Protein
abx600269-02 100 µg

Monkey Interferon Gamma Receptor 1 (IFNGR1) Protein

Sign In for Pricing
View Details
Monkey Interferon Gamma Receptor 1 (IFNGR1) Protein
abx600269-03 1 mg

Monkey Interferon Gamma Receptor 1 (IFNGR1) Protein

Sign In for Pricing
View Details
Fam123a sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3431003 1.0 µg DNA

Fam123a sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
ANPRB (6S5) Rabbit Monoclonal Antibody
AMRe06938-01 50 µL

ANPRB (6S5) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details