Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLUR2)

This Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLUR2) spans the amino acid sequence from region 23-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secreted Ly-6/uPAR domain-containing protein 2; Secreted LY6/PLAUR domain-containing protein 2; Secreted Ly-6/uPAR-related protein 2; SLURP-2; SLURP2

UniProt

P0DP57

Expression Region

23-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB19 siRNA Oligos set (Human)
38304171 3x 5 nmol

RAB19 siRNA Oligos set (Human)

Sign In for Pricing
View Details
TSSK 6 (F-6) : m-IgG Fc BP-HRP Bundle
sc-531021 1 Kit

TSSK 6 (F-6) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
SLAIN2 Antibody
MBS9411659-01 0.1 mL

SLAIN2 Antibody

Sign In for Pricing
View Details
SLAIN2 Antibody
MBS9411659-02 5x 0.1 mL

SLAIN2 Antibody

Sign In for Pricing
View Details
Calpastatin (CAST) Mouse Monoclonal Antibody [Clone ID: OTI1E7]
TA504351 100 µL

Calpastatin (CAST) Mouse Monoclonal Antibody [Clone ID: OTI1E7]

Sign In for Pricing
View Details
RTP2 Antibody, Biotin conjugated
A57761-100UG 100 µg

RTP2 Antibody, Biotin conjugated

Sign In for Pricing
View Details