Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial

This Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endothelin-converting enzyme 2; ECE-2; EC 3.4.24.71; ECE2 KIAA0604 UNQ403/PRO740

UniProt

P0DPD6

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Protein Biochemistry

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNVALQELGAGSNMVEYKRATLRDEDAPETPVEGGASPDAMEVGKGASPFSPGPSPGMTPGTPRSSGLFWRVTCPHLRSISGLCSRTMVGFQKGTRQLLGSRTQLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kpna5 (NM_001025113) Rat Untagged Clone
RN212168 10 µg

Kpna5 (NM_001025113) Rat Untagged Clone

Sign In for Pricing
View Details
Solithromycin 2mg
A14031-2 2 mg

Solithromycin 2mg

Sign In for Pricing
View Details
Anti-Calpain 3/CAPN3 Antibody Picoband®, Carrier-free
A02170-2-carrier-free 100 µg/Vial

Anti-Calpain 3/CAPN3 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Mouse Monoclonal PGAM2 Antibody (OTI4E9) [Dylight 594]
NBP2-73358DL594 0.1 mL

Mouse Monoclonal PGAM2 Antibody (OTI4E9) [Dylight 594]

Sign In for Pricing
View Details
Mouse Monoclonal Chikungunya virus Antibody (6A11) [DyLight 650]
NBP2-53111C 0.1 mL

Mouse Monoclonal Chikungunya virus Antibody (6A11) [DyLight 650]

Sign In for Pricing
View Details
STAF-50 (P100888_P050)
P100888_P050 100 µL

STAF-50 (P100888_P050)

Sign In for Pricing
View Details