Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H3.X (H3Y2)

This Recombinant Human Histone H3.X (H3Y2) spans the amino acid sequence from region 2-147. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H3.X; Histone H3.Y2; H3Y2

UniProt

P0DPK5

Expression Region

2-147

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ARTKQTARKATAWQAPRKPLATKAARKRASPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRGEGAGEPTLLGNLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL9 ELISA Kit (Mouse) (OKAN05035)
OKAN05035 96 Well

CCL9 ELISA Kit (Mouse) (OKAN05035)

Sign In for Pricing
View Details
C1QTNF3 Antibody, Biotin conjugated
CSB-PA003648LD01HU-01 50 µg

C1QTNF3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
C1QTNF3 Antibody, Biotin conjugated
CSB-PA003648LD01HU-02 100 µg

C1QTNF3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Anaerococcus prevotii Probe-based qPCR Kit
MK1F685-01 48 Test

Anaerococcus prevotii Probe-based qPCR Kit

Sign In for Pricing
View Details
Anaerococcus prevotii Probe-based qPCR Kit
MK1F685-02 50 Tests

Anaerococcus prevotii Probe-based qPCR Kit

Sign In for Pricing
View Details
Bordetella pertussis Antibody [5111]
orb1273105 0.1 mg

Bordetella pertussis Antibody [5111]

Sign In for Pricing
View Details