Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H3.X (H3Y2)

This Recombinant Human Histone H3.X (H3Y2) spans the amino acid sequence from region 2-147. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H3.X; Histone H3.Y2; H3Y2

UniProt

P0DPK5

Expression Region

2-147

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ARTKQTARKATAWQAPRKPLATKAARKRASPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRGEGAGEPTLLGNLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0571106 1.0 µg DNA

DDX4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Lentiviral mouse Med9 shRNA (UAS) - Lentiviral mouse Med9 shRNA (UAS, iRFP) plasmid
GTR15213496 1 Vial

Lentiviral mouse Med9 shRNA (UAS) - Lentiviral mouse Med9 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
EDIL3-set siRNA/shRNA/RNAi Lentivector (Human)
18918091 4x 500 ng

EDIL3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
SSX2IP (Synovial Sarcoma X Breakpoint 2 Interacting Protein, SSX2-interacting Protein, Afadin and alpha Actinin Binding Protein, Afadin DIL Domain Interacting Protein, Afadin- and alpha-actinin-binding Protein, ADIP, FLJ10848, KIAA0923, MGC75026)
133883 50 µg

SSX2IP (Synovial Sarcoma X Breakpoint 2 Interacting Protein, SSX2-interacting Protein, Afadin and alpha Actinin Binding Protein, Afadin DIL Domain Interacting Protein, Afadin- and alpha-actinin-binding Protein, ADIP, FLJ10848, KIAA0923, MGC75026)

Sign In for Pricing
View Details
(S) -3-Bromo-±-methylbenzylamine
PFA30596-01 5 g

(S) -3-Bromo-±-methylbenzylamine

Sign In for Pricing
View Details
(S) -3-Bromo-±-methylbenzylamine
PFA30596-02 50 g

(S) -3-Bromo-±-methylbenzylamine

Sign In for Pricing
View Details