Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human M1-specific T cell receptor beta chain (TRBR1), partial

This Recombinant Human M1-specific T cell receptor beta chain (TRBR1), partial spans the amino acid sequence from region 22-276. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

M1-specific T cell receptor beta chain; TR beta chain TRBV19*01J2S7*01C*02; TRB

UniProt

P0DSE2

Expression Region

22-276

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIRSSYEQYFGPGTRLTVTEDLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFE2L1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2468776 100 µL

NFE2L1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
HIST1H1A Antibody
orb752834-01 50 μL

HIST1H1A Antibody

Sign In for Pricing
View Details
HIST1H1A Antibody
orb752834-02 100 µL

HIST1H1A Antibody

Sign In for Pricing
View Details
JIK/TAOK3 Rabbit Polyclonal Antibody (Cy5.5)
orb1069398 100 µL

JIK/TAOK3 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
C9orf156 CRISPR Activation Plasmid (h2)
sc-412213-ACT-2 20 µg

C9orf156 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
CCNP (NM_024877) Human Untagged Clone
SC305177 10 µg

CCNP (NM_024877) Human Untagged Clone

Sign In for Pricing
View Details