Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uridine 5'-monophosphate synthase (UMPS)

This Recombinant Human Uridine 5'-monophosphate synthase (UMPS) spans the amino acid sequence from region 2-480. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uridine 5'-monophosphate synthase; UMP synthase; [Includes: Orotate phosphoribosyltransferase; OPRT; OPRTase; EC 2.4.2.10; Orotidine 5'-phosphate decarboxylase; ODC; OMPD; EC 4.1.1.23; OMPdecase] UMPS OK/SW-cl.21

UniProt

P11172

Expression Region

2-480

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUSE sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0821907 1.0 µg DNA

FUSE sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Guinea Pig anti-Ionotropic Glutamate receptor 1 antibody ELISA kit
GTR10453513 96 Well

Guinea Pig anti-Ionotropic Glutamate receptor 1 antibody ELISA kit

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Armenian Hamster IgG (H+L) Secondary Antibody [Alkaline Phosphatase]
NB120-5746 0.5 mg

Goat Polyclonal Goat anti-Armenian Hamster IgG (H+L) Secondary Antibody [Alkaline Phosphatase]

Sign In for Pricing
View Details
P38 phospho-Thr180/Tyr182 Rabbit Polyclonal Antibody
E53P01668 100 µL

P38 phospho-Thr180/Tyr182 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 DNA-directed RNA polymerase subunit beta (rpoB), partial
MBS1071266 Inquire

Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 DNA-directed RNA polymerase subunit beta (rpoB), partial

Sign In for Pricing
View Details
KIF1A Rabbit Polyclonal Antibody (Cy3)
orb2589493 100 µg

KIF1A Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details