Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inosine-5'-monophosphate dehydrogenase 1 (IMDH1)

This Recombinant Human Inosine-5'-monophosphate dehydrogenase 1 (IMDH1) spans the amino acid sequence from region 2-514. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Inosine-5'-monophosphate dehydrogenase 1; IMP dehydrogenase 1; IMPD 1; IMPDH 1; EC 1.1.1.205; IMPDH-I; IMPDH1 IMPD1

UniProt

P20839

Expression Region

2-514

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CXCR1/IL-8RA Antibody (42709) [DyLight 350]
FAB3302D 0.1 mL

Mouse Monoclonal CXCR1/IL-8RA Antibody (42709) [DyLight 350]

Sign In for Pricing
View Details
WCRF Double Nickase Plasmid (h2)
sc-407304-NIC-2 20 µg

WCRF Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Rpap2 (NM_001013987) Rat Tagged ORF Clone Lentiviral Particle
RR204920L4V 200 µL

Rpap2 (NM_001013987) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AF488 Anti-Human CD123 Antibody
JOT21449F 20Tests

AF488 Anti-Human CD123 Antibody

Sign In for Pricing
View Details
MT1B CytoSection
TS418275P5 25 Slides

MT1B CytoSection

Sign In for Pricing
View Details
Chmp1b (NM_024190) Mouse Tagged Lenti ORF Clone
MR202011L4 10 µg

Chmp1b (NM_024190) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details