Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 3',5'-cyclic-AMP phosphodiesterase 4A (PDE4A), partial

This Recombinant Human 3',5'-cyclic-AMP phosphodiesterase 4A (PDE4A), partial spans the amino acid sequence from region 357-686. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

3',5'-cyclic-AMP phosphodiesterase 4A; EC 3.1.4.53; DPDE2; PDE46; cAMP-specific phosphodiesterase 4A; PDE4A DPDE2

UniProt

P27815

Expression Region

357-686

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VKTDQEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYMLTLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLELYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDNRDWYYSAIRQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TTI2 Knockout A549 cell line
GTR15405219 1 Vial

Human TTI2 Knockout A549 cell line

Sign In for Pricing
View Details
CD3-ζ/η Lentiviral Activation Particles (m)
sc-419556-LAC 200 µL

CD3-ζ/η Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
PXMP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1763506 1.0 µg DNA

PXMP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Glipr1 sgRNA CRISPR Lentivector set (Rat)
K7345501 3x 1.0 µg

Glipr1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Lentiviral human RAD23B shRNA (UAS) - Lentiviral human RAD23B shRNA (UAS, RFP) (25)
GTR15101603 1 Vial

Lentiviral human RAD23B shRNA (UAS) - Lentiviral human RAD23B shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rabbit Monoclonal MDR1/ABCB1 Antibody (MDR1/8986R) [FITC]
NBP3-24231F 0.1 mL

Rabbit Monoclonal MDR1/ABCB1 Antibody (MDR1/8986R) [FITC]

Sign In for Pricing
View Details