Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-adrenomedullin (ADML), partial

This Recombinant Human Pro-adrenomedullin (ADML), partial spans the amino acid sequence from region 95-146. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-adrenomedullin [Cleaved into: Adrenomedullin; AM; Proadrenomedullin N-20 terminal peptide; ProAM N-terminal 20 peptide; PAMP; ProAM-N20] ADM AM

UniProt

P35318

Expression Region

95-146

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Natriuretic Peptide Receptor C (NPR3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11H6]
TA501080BM 100 µL

Natriuretic Peptide Receptor C (NPR3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11H6]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG1,  30nm
GM-300-30 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG1, 30nm

Sign In for Pricing
View Details
1-[2-(4-Morpholinyl)ethyl-d4]-3-(1-naphthoyl)indole JWH 200-d4
TRC-M723767-1MG 1 mg

1-[2-(4-Morpholinyl)ethyl-d4]-3-(1-naphthoyl)indole JWH 200-d4

Sign In for Pricing
View Details
Mitochondria Mouse Monoclonal Antibody [Clone ID: MTC02]
AM33293PU-S 100 µg

Mitochondria Mouse Monoclonal Antibody [Clone ID: MTC02]

Sign In for Pricing
View Details
FPRL1 (FPR2) (2nd extracell. loop) Rabbit Polyclonal Antibody
AP32357PU-N 100 µg

FPRL1 (FPR2) (2nd extracell. loop) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GFP | Green Fluorescence Protein - DyLight® 594 conjugated (40 µg)
AS20 4443-DL594 40 µg

Anti-GFP | Green Fluorescence Protein - DyLight® 594 conjugated (40 µg)

Sign In for Pricing
View Details