Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-dependent kinase 6 (CDK6)

This Recombinant Human Cyclin-dependent kinase 6 (CDK6) spans the amino acid sequence from region 1-326. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cyclin-dependent kinase 6; EC 2.7.11.22; Cell division protein kinase 6; Serine/threonine-protein kinase PLSTIRE; CDK6 CDKN6

UniProt

Q00534

Expression Region

1-326

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR7 Human Gene Knockout Kit (CRISPR)
KN207515 1 Kit

TLR7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HOXC6 (NM_153693) Human Over-expression Lysate
LY403515 100 µg

HOXC6 (NM_153693) Human Over-expression Lysate

Sign In for Pricing
View Details
AATOM™ 610 maleimide
70252-AAT 1 mg

AATOM™ 610 maleimide

Sign In for Pricing
View Details
CFC1 Antibody
OC-588-01 50 μL

CFC1 Antibody

Sign In for Pricing
View Details
CFC1 Antibody
OC-588-02 100 µL

CFC1 Antibody

Sign In for Pricing
View Details
CFC1 Antibody
OC-588-03 1 mL

CFC1 Antibody

Sign In for Pricing
View Details