Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-dependent kinase 6 (CDK6)

This Recombinant Human Cyclin-dependent kinase 6 (CDK6) spans the amino acid sequence from region 1-326. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cyclin-dependent kinase 6; EC 2.7.11.22; Cell division protein kinase 6; Serine/threonine-protein kinase PLSTIRE; CDK6 CDKN6

UniProt

Q00534

Expression Region

1-326

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLIG1 siRNA (Rat)
MBS8230198-01 15 nmol

OLIG1 siRNA (Rat)

Sign In for Pricing
View Details
OLIG1 siRNA (Rat)
MBS8230198-02 30 nmol

OLIG1 siRNA (Rat)

Sign In for Pricing
View Details
OLIG1 siRNA (Rat)
MBS8230198-03 5x 30 nmol

OLIG1 siRNA (Rat)

Sign In for Pricing
View Details
Kctd7 Mouse shRNA Plasmid (Locus ID 212919)
TR513110 1 Kit

Kctd7 Mouse shRNA Plasmid (Locus ID 212919)

Sign In for Pricing
View Details
EMP1 Antibody (Biotin)
orb23744-01 50 µg

EMP1 Antibody (Biotin)

Sign In for Pricing
View Details
EMP1 Antibody (Biotin)
orb23744-02 100 µg

EMP1 Antibody (Biotin)

Sign In for Pricing
View Details