Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Photoreceptor disk component PRCD (PRCD)

This Recombinant Human Photoreceptor disk component PRCD (PRCD) spans the amino acid sequence from region 1-54. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Photoreceptor disk component PRCD; Progressive rod-cone degeneration protein; PRCD

UniProt

Q00LT1

Expression Region

1-54

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RA Antigen (CD45RA/PTPRC) Antibody (PE / Cyanine 7)
abx228512-01 20 Tests

CD45RA Antigen (CD45RA/PTPRC) Antibody (PE / Cyanine 7)

Sign In for Pricing
View Details
CD45RA Antigen (CD45RA/PTPRC) Antibody (PE / Cyanine 7)
abx228512-02 100 Tests

CD45RA Antigen (CD45RA/PTPRC) Antibody (PE / Cyanine 7)

Sign In for Pricing
View Details
CD45RA Antigen (CD45RA/PTPRC) Antibody (PE / Cyanine 7)
abx228512-03 200 Tests

CD45RA Antigen (CD45RA/PTPRC) Antibody (PE / Cyanine 7)

Sign In for Pricing
View Details
SCFD2 cDNA Clone
MBS1268884-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

SCFD2 cDNA Clone

Sign In for Pricing
View Details
SCFD2 cDNA Clone
MBS1268884-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

SCFD2 cDNA Clone

Sign In for Pricing
View Details
Olfr913 ORF Vector (Mouse) (pORF)
33542014 1.0 µg DNA

Olfr913 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details