Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Photoreceptor disk component PRCD (PRCD)

This Recombinant Human Photoreceptor disk component PRCD (PRCD) spans the amino acid sequence from region 1-54. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Photoreceptor disk component PRCD; Progressive rod-cone degeneration protein; PRCD

UniProt

Q00LT1

Expression Region

1-54

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Patatin-Like Phospholipase Domain Containing 2 (PNPLA2) Goat anti-Mouse Polyclonal (Internal) Antibody
GWB-F06E06 0.05 mg

Patatin-Like Phospholipase Domain Containing 2 (PNPLA2) Goat anti-Mouse Polyclonal (Internal) Antibody

Sign In for Pricing
View Details
Human Cadherin, Heart (CDHH) ELISA Kit
QY-E00835 96 Tests

Human Cadherin, Heart (CDHH) ELISA Kit

Sign In for Pricing
View Details
Bovine Estradiol (E2) ELISA Kit
YP-W77039-01 48 Tests

Bovine Estradiol (E2) ELISA Kit

Sign In for Pricing
View Details
Bovine Estradiol (E2) ELISA Kit
YP-W77039-02 96 Tests

Bovine Estradiol (E2) ELISA Kit

Sign In for Pricing
View Details
Boc-D-norleucine
BA9433-10000 10 g

Boc-D-norleucine

Sign In for Pricing
View Details
Human Uncharacterized protein C14orf105, C14orf105 ELISA Kit
MBS9330720-01 48 Well

Human Uncharacterized protein C14orf105, C14orf105 ELISA Kit

Sign In for Pricing
View Details