Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-9 receptor (IL9R), partial

This Recombinant Human Interleukin-9 receptor (IL9R), partial spans the amino acid sequence from region 41-270. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-9 receptor; IL-9R; CD129

UniProt

Q01113

Expression Region

41-270aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.8 kDa

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bat coronavirus 512/2005 Envelope small membrane protein (E), partial
MBS1445897-01 0.5 mg (E-Coli)

Recombinant Bat coronavirus 512/2005 Envelope small membrane protein (E), partial

Sign In for Pricing
View Details
Recombinant Bat coronavirus 512/2005 Envelope small membrane protein (E), partial
MBS1445897-02 0.05 mg (Baculovirus)

Recombinant Bat coronavirus 512/2005 Envelope small membrane protein (E), partial

Sign In for Pricing
View Details
Recombinant Bat coronavirus 512/2005 Envelope small membrane protein (E), partial
MBS1445897-03 0.5 mg (Yeast)

Recombinant Bat coronavirus 512/2005 Envelope small membrane protein (E), partial

Sign In for Pricing
View Details
Recombinant Bat coronavirus 512/2005 Envelope small membrane protein (E), partial
MBS1445897-04 0.05 mg (Mammalian-Cell)

Recombinant Bat coronavirus 512/2005 Envelope small membrane protein (E), partial

Sign In for Pricing
View Details
Recombinant Bat coronavirus 512/2005 Envelope small membrane protein (E), partial
MBS1445897-05 1 mg (E-Coli)

Recombinant Bat coronavirus 512/2005 Envelope small membrane protein (E), partial

Sign In for Pricing
View Details
Recombinant Bat coronavirus 512/2005 Envelope small membrane protein (E), partial
MBS1445897-06 0.1 mg (Baculovirus)

Recombinant Bat coronavirus 512/2005 Envelope small membrane protein (E), partial

Sign In for Pricing
View Details