Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial

This Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial spans the amino acid sequence from region 260-338. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium channel protein type 7 subunit alpha; Atypical sodium channel Nav2.1; Nax channel; Sodium channel protein type VII subunit alpha; SCN7A SCN6A

UniProt

Q01118

Expression Region

260-338

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGNLKHKCFRWPQENENETLHNRTGNPYYIRETENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Microvascular Pericyte Cell Complete Medium
CM-M194-01 100 mL

Mouse Microvascular Pericyte Cell Complete Medium

Sign In for Pricing
View Details
Mouse Microvascular Pericyte Cell Complete Medium
CM-M194-02 4x 125 mL

Mouse Microvascular Pericyte Cell Complete Medium

Sign In for Pricing
View Details
Rabbit Monoclonal MICB Antibody (102) [DyLight 755]
NBP2-89627IR 0.1 mL

Rabbit Monoclonal MICB Antibody (102) [DyLight 755]

Sign In for Pricing
View Details
4-Fluorobenzamidine, Hydrochloride, Monohydrate
sc-210042 250 mg

4-Fluorobenzamidine, Hydrochloride, Monohydrate

Sign In for Pricing
View Details
FMOC-beta-N, N-Dimethylamino-l-ala
MYA88086-01 50 mg

FMOC-beta-N, N-Dimethylamino-l-ala

Sign In for Pricing
View Details
FMOC-beta-N, N-Dimethylamino-l-ala
MYA88086-02 0.5 g

FMOC-beta-N, N-Dimethylamino-l-ala

Sign In for Pricing
View Details