Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial

This Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial spans the amino acid sequence from region 260-338. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium channel protein type 7 subunit alpha; Atypical sodium channel Nav2.1; Nax channel; Sodium channel protein type VII subunit alpha; SCN7A SCN6A

UniProt

Q01118

Expression Region

260-338

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGNLKHKCFRWPQENENETLHNRTGNPYYIRETENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Small Intestine, Jejunum cDNA
TD-308 30 Reactions

Rabbit Small Intestine, Jejunum cDNA

Sign In for Pricing
View Details
NAT14 Recombinant Protein (Mouse)
RP153122 100 µg

NAT14 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Human Proteolipid Protein 2, Colonic Epithelium Enriched (PLP2) ELISA Kit
abx152785-01 96 Tests

Human Proteolipid Protein 2, Colonic Epithelium Enriched (PLP2) ELISA Kit

Sign In for Pricing
View Details
Human Proteolipid Protein 2, Colonic Epithelium Enriched (PLP2) ELISA Kit
abx152785-02 5x 96 Tests

Human Proteolipid Protein 2, Colonic Epithelium Enriched (PLP2) ELISA Kit

Sign In for Pricing
View Details
Human Proteolipid Protein 2, Colonic Epithelium Enriched (PLP2) ELISA Kit
abx152785-03 10x 96 Tests

Human Proteolipid Protein 2, Colonic Epithelium Enriched (PLP2) ELISA Kit

Sign In for Pricing
View Details
Hypoxia Inducible Factor 1b (HIF-1b, ARNT, Aryl hydrocarbon Receptor Nuclear Translocator) (Not for Export EU)
H9808-02 100 µL

Hypoxia Inducible Factor 1b (HIF-1b, ARNT, Aryl hydrocarbon Receptor Nuclear Translocator) (Not for Export EU)

Sign In for Pricing
View Details