Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial
This Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial spans the amino acid sequence from region 1-57. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Interferon-induced transmembrane protein 3; Dispanin subfamily A member 2b; DSPA2b; Interferon-inducible protein 1-8U; IFITM3
UniProt
Q01628
Expression Region
1-57
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-B817459-25MG 25 mg
betahydroxybutyryl Coenzyme A Sodium Salt-13C4
Sign In for Pricing
View Details 
