Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human OTU domain-containing protein 4 (OTUD4), partial

This Recombinant Human OTU domain-containing protein 4 (OTUD4), partial spans the amino acid sequence from region 34-155. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OTU domain-containing protein 4; EC 3.4.19.12; HIV-1-induced protein HIN-1; OTUD4 HIN-1 KIAA1046

UniProt

Q01804

Expression Region

34-155

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGNHYDIVYPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3 (acetyl K9) Rabbit Polyclonal Antibody (APC)
orb1006995 100 µL

Histone H3 (acetyl K9) Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
MGST1 Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62485R-PerCP-Cy5.5 100 µL

MGST1 Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
MYBL1 Adenovirus (Human)
31199051 1.0 mL

MYBL1 Adenovirus (Human)

Sign In for Pricing
View Details
CLIA Kit for Lens Epithelium Derived Growth Factor (LEDGF)
MBS2000516-01 24 Strip Well

CLIA Kit for Lens Epithelium Derived Growth Factor (LEDGF)

Sign In for Pricing
View Details
CLIA Kit for Lens Epithelium Derived Growth Factor (LEDGF)
MBS2000516-02 48 Well

CLIA Kit for Lens Epithelium Derived Growth Factor (LEDGF)

Sign In for Pricing
View Details
CLIA Kit for Lens Epithelium Derived Growth Factor (LEDGF)
MBS2000516-03 96 Well

CLIA Kit for Lens Epithelium Derived Growth Factor (LEDGF)

Sign In for Pricing
View Details