Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA-binding protein EWS (EWS)

This Recombinant Human RNA-binding protein EWS (EWS) spans the amino acid sequence from region 1-656. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNA-binding protein EWS; EWS oncogene; Ewing sarcoma breakpoint region 1 protein; EWSR1 EWS

UniProt

Q01844

Expression Region

1-656

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEOX1 (Mesenchyme Homeobox 1, MOX1) (PE)
248681-PE 100 µL

MEOX1 (Mesenchyme Homeobox 1, MOX1) (PE)

Sign In for Pricing
View Details
FANCL Rabbit pAb
orb2713556-01 50 µL

FANCL Rabbit pAb

Sign In for Pricing
View Details
FANCL Rabbit pAb
orb2713556-02 100 µL

FANCL Rabbit pAb

Sign In for Pricing
View Details
TRO Antibody, HRP conjugated
CSB-PA025069LB01HU-01 50 μL

TRO Antibody, HRP conjugated

Sign In for Pricing
View Details
TRO Antibody, HRP conjugated
CSB-PA025069LB01HU-02 100 µL

TRO Antibody, HRP conjugated

Sign In for Pricing
View Details
Monoclonal Antibody to CD59 / Complement Regulatory Protein / Protectin (Clone : SPM616)
36-1954-100 100 µg

Monoclonal Antibody to CD59 / Complement Regulatory Protein / Protectin (Clone : SPM616)

Sign In for Pricing
View Details